PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G258100.1
Common NamePHAVU_003G258100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 309aa    MW: 33688 Da    PI: 7.1526
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G258100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702211.32.4e-651002393154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         +g++sCqdCGnqakkdC h+RCRtCCksrg+dC+thvkstWvpa+krrerqqqla ++++++  ++++ skr+r+        +++t+l+s
  Phvul.003G258100.1 100 EGGISCQDCGNQAKKDCPHMRCRTCCKSRGYDCQTHVKSTWVPASKRRERQQQLAVLQEQQQ--QQRDLSKRPRDP-------TACTRLPS 181
                         6889****************************************************976664..467778888875.......77888887 PP

              DUF702  94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         +e    le  ++P+ vss+a frcvrvs v+d+++ +aYqtav+igGhvfkGiLyd+G+e+
  Phvul.003G258100.1 182 SE---GLEEGHFPSLVSSPAEFRCVRVSCVEDADDRYAYQTAVNIGGHVFKGILYDYGPEN 239
                         74...679999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.3E-64102238IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.6E-27104146IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.4E-25189237IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MANLFSLSGG RGSNNNQQDT TTNNEIPAAE TLFWYAKNDD VSSYRGFELW NQQQEQHVMP  60
PHVRPLLQRD LYSSGVGPSR GVSDDHSSSR SAFVAMRAAE GGISCQDCGN QAKKDCPHMR  120
CRTCCKSRGY DCQTHVKSTW VPASKRRERQ QQLAVLQEQQ QQQRDLSKRP RDPTACTRLP  180
SSEGLEEGHF PSLVSSPAEF RCVRVSCVED ADDRYAYQTA VNIGGHVFKG ILYDYGPENS  240
NNNNSNNSNN YMAGETSAGV AGAQPLNLTA SGVVSSSGAL VDPSSLYSAP VNTFMGGSGT  300
QFFPHTRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156095.10.0hypothetical protein PHAVU_003G258100g
SwissprotQ9SD401e-79SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLV7CD600.0V7CD60_PHAVU; Uncharacterized protein
STRINGGLYMA16G24510.21e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.18e-63Lateral root primordium (LRP) protein-related